Anti RIT1 pAb (ATL-HPA053249)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053249-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RIT1
Alternative Gene Name: MGC125864, MGC125865, RIBB, RIT, ROC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028057: 93%, ENSRNOG00000020232: 91%
Entrez Gene ID: 6016
Uniprot ID: Q92963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT |
| Gene Sequence | AYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT |
| Gene ID - Mouse | ENSMUSG00000028057 |
| Gene ID - Rat | ENSRNOG00000020232 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RIT1 pAb (ATL-HPA053249) | |
| Datasheet | Anti RIT1 pAb (ATL-HPA053249) Datasheet (External Link) |
| Vendor Page | Anti RIT1 pAb (ATL-HPA053249) at Atlas Antibodies |
| Documents & Links for Anti RIT1 pAb (ATL-HPA053249) | |
| Datasheet | Anti RIT1 pAb (ATL-HPA053249) Datasheet (External Link) |
| Vendor Page | Anti RIT1 pAb (ATL-HPA053249) |
| Citations for Anti RIT1 pAb (ATL-HPA053249) – 2 Found |
| Emery, Andrew C; Xu, Wenqin; Eiden, Maribeth V; Eiden, Lee E. Guanine nucleotide exchange factor Epac2-dependent activation of the GTP-binding protein Rap2A mediates cAMP-dependent growth arrest in neuroendocrine cells. The Journal Of Biological Chemistry. 2017;292(29):12220-12231. PubMed |
| Takahara, Shingo; Inoue, Shin-Ichi; Miyagawa-Tomita, Sachiko; Matsuura, Katsuhisa; Nakashima, Yasumi; Niihori, Tetsuya; Matsubara, Yoichi; Saiki, Yoshikatsu; Aoki, Yoko. New Noonan syndrome model mice with RIT1 mutation exhibit cardiac hypertrophy and susceptibility to β-adrenergic stimulation-induced cardiac fibrosis. Ebiomedicine. 2019;42( 30898653):43-53. PubMed |