Anti RIPK3 pAb (ATL-HPA055087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055087-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RIPK3
Alternative Gene Name: RIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022221: 38%, ENSRNOG00000020465: 38%
Entrez Gene ID: 11035
Uniprot ID: Q9Y572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG |
| Gene Sequence | EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG |
| Gene ID - Mouse | ENSMUSG00000022221 |
| Gene ID - Rat | ENSRNOG00000020465 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RIPK3 pAb (ATL-HPA055087) | |
| Datasheet | Anti RIPK3 pAb (ATL-HPA055087) Datasheet (External Link) |
| Vendor Page | Anti RIPK3 pAb (ATL-HPA055087) at Atlas Antibodies |
| Documents & Links for Anti RIPK3 pAb (ATL-HPA055087) | |
| Datasheet | Anti RIPK3 pAb (ATL-HPA055087) Datasheet (External Link) |
| Vendor Page | Anti RIPK3 pAb (ATL-HPA055087) |
| Citations for Anti RIPK3 pAb (ATL-HPA055087) – 1 Found |
| Du, Yongrui; Bagnjuk, Konstantin; Lawson, Maralee S; Xu, Jing; Mayerhofer, Artur. Acetylcholine and necroptosis are players in follicular development in primates. Scientific Reports. 2018;8(1):6166. PubMed |