Anti RIMS3 pAb (ATL-HPA055285)

Atlas Antibodies

Catalog No.:
ATL-HPA055285-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: regulating synaptic membrane exocytosis 3
Gene Name: RIMS3
Alternative Gene Name: NIM3, RIM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032890: 100%, ENSRNOG00000011171: 100%
Entrez Gene ID: 9783
Uniprot ID: Q9UJD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVAIVGLTQWSKSTLQLPQPEGATKKLRSNIRR
Gene Sequence MVAIVGLTQWSKSTLQLPQPEGATKKLRSNIRR
Gene ID - Mouse ENSMUSG00000032890
Gene ID - Rat ENSRNOG00000011171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RIMS3 pAb (ATL-HPA055285)
Datasheet Anti RIMS3 pAb (ATL-HPA055285) Datasheet (External Link)
Vendor Page Anti RIMS3 pAb (ATL-HPA055285) at Atlas Antibodies

Documents & Links for Anti RIMS3 pAb (ATL-HPA055285)
Datasheet Anti RIMS3 pAb (ATL-HPA055285) Datasheet (External Link)
Vendor Page Anti RIMS3 pAb (ATL-HPA055285)