Anti RIMS3 pAb (ATL-HPA055285)

Atlas Antibodies

Catalog No.: ATL-HPA055285-25

Protein Description: regulating synaptic membrane exocytosis 3
Gene Name: RIMS3
Alternative Gene Name: NIM3, RIM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032890: 100%, ENSRNOG00000011171: 100%
Entrez Gene ID: 9783
Uniprot ID: Q9UJD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVAIVGLTQWSKSTLQLPQPEGATKKLRSNIRR
• Gene Sequence: MVAIVGLTQWSKSTLQLPQPEGATKKLRSNIRR
• Gene ID - Mouse: ENSMUSG00000032890
• Gene ID - Rat: ENSRNOG00000011171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.