Anti RIC8B pAb (ATL-HPA039970)

Atlas Antibodies

Catalog No.: ATL-HPA039970-25

Protein Description: RIC8 guanine nucleotide exchange factor B
Gene Name: RIC8B
Alternative Gene Name: FLJ10620, hSyn, RIC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035620: 94%, ENSRNOG00000007323: 91%
Entrez Gene ID: 55188
Uniprot ID: Q9NVN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSL
• Gene Sequence: EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSL
• Gene ID - Mouse: ENSMUSG00000035620
• Gene ID - Rat: ENSRNOG00000007323
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.