Anti RHOXF1 pAb (ATL-HPA056506)

Atlas Antibodies

SKU: ATL-HPA056506-25

• 

Protein Description: Rhox homeobox family, member 1
Gene Name: RHOXF1
Alternative Gene Name: OTEX, PEPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023443: 48%, ENSRNOG00000053562: 47%
Entrez Gene ID: 158800
Uniprot ID: Q8NHV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWF
• Gene Sequence: AMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWF
• Gene ID - Mouse: ENSMUSG00000023443
• Gene ID - Rat: ENSRNOG00000053562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.