Anti RHOT1 pAb (ATL-HPA010687)

Atlas Antibodies

Catalog No.: ATL-HPA010687-25

Protein Description: ras homolog family member T1
Gene Name: RHOT1
Alternative Gene Name: ARHT1, FLJ11040, MIRO-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017686: 100%, ENSRNOG00000004093: 100%
Entrez Gene ID: 55288
Uniprot ID: Q8IXI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
• Gene Sequence: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
• Gene ID - Mouse: ENSMUSG00000017686
• Gene ID - Rat: ENSRNOG00000004093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RHOT1 pAb (ATL-HPA010687) – 19 Found

Gersch, Malte; Gladkova, Christina; Schubert, Alexander F; Michel, Martin A; Maslen, Sarah; Komander, David. Mechanism and regulation of the Lys6-selective deubiquitinase USP30. Nature Structural & Molecular Biology. 2017;24(11):920-930. 

McLelland, Gian-Luca; Goiran, Thomas; Yi, Wei; Dorval, Geneviève; Chen, Carol X; Lauinger, Nadine D; Krahn, Andrea I; Valimehr, Sepideh; Rakovic, Aleksandar; Rouiller, Isabelle; Durcan, Thomas M; Trempe, Jean-François; Fon, Edward A. Mfn2 ubiquitination by PINK1/parkin gates the p97-dependent release of ER from mitochondria to drive mitophagy. Elife. 2018;7( 29676259) 

Safiulina, Dzhamilja; Kuum, Malle; Choubey, Vinay; Gogichaishvili, Nana; Liiv, Joanna; Hickey, Miriam A; Cagalinec, Michal; Mandel, Merle; Zeb, Akbar; Liiv, Mailis; Kaasik, Allen. Miro proteins prime mitochondria for Parkin translocation and mitophagy. The Embo Journal. 2019;38(2) 

Kontou, Georgina; Antonoudiou, Pantelis; Podpolny, Marina; Szulc, Blanka R; Arancibia-Carcamo, I Lorena; Higgs, Nathalie F; Lopez-Domenech, Guillermo; Salinas, Patricia C; Mann, Edward O; Kittler, Josef T. Miro1-dependent mitochondrial dynamics in parvalbumin interneurons. Elife. 2021;10( 34190042) 

Li, Li; Conradson, Devon M; Bharat, Vinita; Kim, Min Joo; Hsieh, Chung-Han; Minhas, Paras S; Papakyrikos, Amanda M; Durairaj, Aarooran Sivakumaran; Ludlam, Anthony; Andreasson, Katrin I; Partridge, Linda; Cianfrocco, Michael A; Wang, Xinnan. A mitochondrial membrane-bridging machinery mediates signal transduction of intramitochondrial oxidation. Nature Metabolism. 2021;3(9):1242-1258. 

De Vos, Kurt J; Mórotz, Gábor M; Stoica, Radu; Tudor, Elizabeth L; Lau, Kwok-Fai; Ackerley, Steven; Warley, Alice; Shaw, Christopher E; Miller, Christopher C J. VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasis. Human Molecular Genetics. 2012;21(6):1299-311. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Birsa, Nicol; Norkett, Rosalind; Wauer, Tobias; Mevissen, Tycho E T; Wu, Hsiu-Chuan; Foltynie, Thomas; Bhatia, Kailash; Hirst, Warren D; Komander, David; Plun-Favreau, Helene; Kittler, Josef T. Lysine 27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase. The Journal Of Biological Chemistry. 2014;289(21):14569-82. 

Bingol, Baris; Tea, Joy S; Phu, Lilian; Reichelt, Mike; Bakalarski, Corey E; Song, Qinghua; Foreman, Oded; Kirkpatrick, Donald S; Sheng, Morgan. The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy. Nature. 2014;510(7505):370-5. 

Kanfer, Gil; Courthéoux, Thibault; Peterka, Martin; Meier, Sonja; Soste, Martin; Melnik, Andre; Reis, Katarina; Aspenström, Pontus; Peter, Matthias; Picotti, Paola; Kornmann, Benoît. Mitotic redistribution of the mitochondrial network by Miro and Cenp-F. Nature Communications. 2015;6( 26259702):8015. 

Norkett, Rosalind; Modi, Souvik; Birsa, Nicol; Atkin, Talia A; Ivankovic, Davor; Pathania, Manav; Trossbach, Svenja V; Korth, Carsten; Hirst, Warren D; Kittler, Josef T. DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites. The Journal Of Biological Chemistry. 2016;291(2):613-29. 

Stephen, Terri-Leigh; Higgs, Nathalie F; Sheehan, David F; Al Awabdh, Sana; López-Doménech, Guillermo; Arancibia-Carcamo, I Lorena; Kittler, Josef T. Miro1 Regulates Activity-Driven Positioning of Mitochondria within Astrocytic Processes Apposed to Synapses to Regulate Intracellular Calcium Signaling. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(48):15996-6011. 

Mills, Kate M; Brocardo, Mariana G; Henderson, Beric R. APC binds the Miro/Milton motor complex to stimulate transport of mitochondria to the plasma membrane. Molecular Biology Of The Cell. 2016;27(3):466-82. 

Zhou, Bing; Yu, Panpan; Lin, Mei-Yao; Sun, Tao; Chen, Yanmin; Sheng, Zu-Hang. Facilitation of axon regeneration by enhancing mitochondrial transport and rescuing energy deficits. The Journal Of Cell Biology. 2016;214(1):103-19. 

Shaltouki, Atossa; Hsieh, Chung-Han; Kim, Min Joo; Wang, Xinnan. Alpha-synuclein delays mitophagy and targeting Miro rescues neuron loss in Parkinson's models. Acta Neuropathologica. 2018;136(4):607-620. 

Schulman, Jacqualyn J; Szczesniak, Laura M; Bunker, Eric N; Nelson, Heather A; Roe, Michael W; Wagner, Larry E 2nd; Yule, David I; Wojcikiewicz, Richard J H. Bok regulates mitochondrial fusion and morphology. Cell Death And Differentiation. 2019;26(12):2682-2694. 

Hsieh, Chung-Han; Li, Li; Vanhauwaert, Roeland; Nguyen, Kong T; Davis, Mary D; Bu, Guojun; Wszolek, Zbigniew K; Wang, Xinnan. Miro1 Marks Parkinson's Disease Subset and Miro1 Reducer Rescues Neuron Loss in Parkinson's Models. Cell Metabolism. 2019;30(6):1131-1140.e7. 

Bharat, Vinita; Hsieh, Chung-Han; Wang, Xinnan. Mitochondrial Defects in Fibroblasts of Pathogenic MAPT Patients. Frontiers In Cell And Developmental Biology. 9( 34805172):765408. 

Dentoni, Giacomo; Naia, Luana; Portal, Benjamin; Leal, Nuno Santos; Nilsson, Per; Lindskog, Maria; Ankarcrona, Maria. Mitochondrial Alterations in Neurons Derived from the Murine AppNL-F Knock-In Model of Alzheimer's Disease. Journal Of Alzheimer's Disease : Jad. 90(2):565-583.