Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003050-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ras homolog family member J
Gene Name: RHOJ
Alternative Gene Name: ARHJ, FLJ14445, RASL7B, TCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046768: 96%, ENSRNOG00000021919: 96%
Entrez Gene ID: 57381
Uniprot ID: Q9H4E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG
Gene Sequence CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG
Gene ID - Mouse ENSMUSG00000046768
Gene ID - Rat ENSRNOG00000021919
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation)
Datasheet Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation)
Datasheet Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation)
Citations for Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) – 2 Found
Chen, Baoyu; Zhu, Yuwen; Chen, Junliang; Feng, Yifei; Xu, Yong. Activation of TC10-Like Transcription by Lysine Demethylase KDM4B in Colorectal Cancer Cells. Frontiers In Cell And Developmental Biology. 9( 34249900):617549.  PubMed
Chen, Baoyu; Yuan, Yibiao; Sun, Lina; Chen, Junliang; Yang, Mengzhu; Yin, Yongmei; Xu, Yong. MKL1 Mediates TGF-β Induced RhoJ Transcription to Promote Breast Cancer Cell Migration and Invasion. Frontiers In Cell And Developmental Biology. 8( 32984327):832.  PubMed