Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003050-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RHOJ
Alternative Gene Name: ARHJ, FLJ14445, RASL7B, TCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046768: 96%, ENSRNOG00000021919: 96%
Entrez Gene ID: 57381
Uniprot ID: Q9H4E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG |
| Gene Sequence | CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG |
| Gene ID - Mouse | ENSMUSG00000046768 |
| Gene ID - Rat | ENSRNOG00000021919 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) | |
| Datasheet | Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) | |
| Datasheet | Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) |
| Citations for Anti RHOJ pAb (ATL-HPA003050 w/enhanced validation) – 2 Found |
| Chen, Baoyu; Zhu, Yuwen; Chen, Junliang; Feng, Yifei; Xu, Yong. Activation of TC10-Like Transcription by Lysine Demethylase KDM4B in Colorectal Cancer Cells. Frontiers In Cell And Developmental Biology. 9( 34249900):617549. PubMed |
| Chen, Baoyu; Yuan, Yibiao; Sun, Lina; Chen, Junliang; Yang, Mengzhu; Yin, Yongmei; Xu, Yong. MKL1 Mediates TGF-β Induced RhoJ Transcription to Promote Breast Cancer Cell Migration and Invasion. Frontiers In Cell And Developmental Biology. 8( 32984327):832. PubMed |