Anti RHOH pAb (ATL-HPA061314)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061314-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RHOH
Alternative Gene Name: ARHH, RhoH, TTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029204: 100%, ENSRNOG00000002540: 99%
Entrez Gene ID: 399
Uniprot ID: Q15669
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKN |
| Gene Sequence | VRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKN |
| Gene ID - Mouse | ENSMUSG00000029204 |
| Gene ID - Rat | ENSRNOG00000002540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RHOH pAb (ATL-HPA061314) | |
| Datasheet | Anti RHOH pAb (ATL-HPA061314) Datasheet (External Link) |
| Vendor Page | Anti RHOH pAb (ATL-HPA061314) at Atlas Antibodies |
| Documents & Links for Anti RHOH pAb (ATL-HPA061314) | |
| Datasheet | Anti RHOH pAb (ATL-HPA061314) Datasheet (External Link) |
| Vendor Page | Anti RHOH pAb (ATL-HPA061314) |