Anti RHOC pAb (ATL-HPA051461)

Atlas Antibodies

Catalog No.:
ATL-HPA051461-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ras homolog family member C
Gene Name: RHOC
Alternative Gene Name: ARH9, ARHC, RhoC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049739: 29%, ENSRNOG00000020778: 31%
Entrez Gene ID: 389
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
Gene Sequence KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
Gene ID - Mouse ENSMUSG00000049739
Gene ID - Rat ENSRNOG00000020778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHOC pAb (ATL-HPA051461)
Datasheet Anti RHOC pAb (ATL-HPA051461) Datasheet (External Link)
Vendor Page Anti RHOC pAb (ATL-HPA051461) at Atlas Antibodies

Documents & Links for Anti RHOC pAb (ATL-HPA051461)
Datasheet Anti RHOC pAb (ATL-HPA051461) Datasheet (External Link)
Vendor Page Anti RHOC pAb (ATL-HPA051461)