Anti RHOBTB2 pAb (ATL-HPA060938)

Atlas Antibodies

Catalog No.:
ATL-HPA060938-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho-related BTB domain containing 2
Gene Name: RHOBTB2
Alternative Gene Name: DBC2, KIAA0717
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022075: 98%, ENSRNOG00000017373: 98%
Entrez Gene ID: 23221
Uniprot ID: Q9BYZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
Gene Sequence GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
Gene ID - Mouse ENSMUSG00000022075
Gene ID - Rat ENSRNOG00000017373
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHOBTB2 pAb (ATL-HPA060938)
Datasheet Anti RHOBTB2 pAb (ATL-HPA060938) Datasheet (External Link)
Vendor Page Anti RHOBTB2 pAb (ATL-HPA060938) at Atlas Antibodies

Documents & Links for Anti RHOBTB2 pAb (ATL-HPA060938)
Datasheet Anti RHOBTB2 pAb (ATL-HPA060938) Datasheet (External Link)
Vendor Page Anti RHOBTB2 pAb (ATL-HPA060938)