Anti RHEBL1 pAb (ATL-HPA053111)

Atlas Antibodies

Catalog No.:
ATL-HPA053111-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras homolog enriched in brain like 1
Gene Name: RHEBL1
Alternative Gene Name: FLJ25797, MGC34869
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023755: 93%, ENSRNOG00000054385: 92%
Entrez Gene ID: 121268
Uniprot ID: Q8TAI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLV
Gene Sequence MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLV
Gene ID - Mouse ENSMUSG00000023755
Gene ID - Rat ENSRNOG00000054385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHEBL1 pAb (ATL-HPA053111)
Datasheet Anti RHEBL1 pAb (ATL-HPA053111) Datasheet (External Link)
Vendor Page Anti RHEBL1 pAb (ATL-HPA053111) at Atlas Antibodies

Documents & Links for Anti RHEBL1 pAb (ATL-HPA053111)
Datasheet Anti RHEBL1 pAb (ATL-HPA053111) Datasheet (External Link)
Vendor Page Anti RHEBL1 pAb (ATL-HPA053111)