Anti RHEBL1 pAb (ATL-HPA053111)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053111-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RHEBL1
Alternative Gene Name: FLJ25797, MGC34869
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023755: 93%, ENSRNOG00000054385: 92%
Entrez Gene ID: 121268
Uniprot ID: Q8TAI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLV |
| Gene Sequence | MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLV |
| Gene ID - Mouse | ENSMUSG00000023755 |
| Gene ID - Rat | ENSRNOG00000054385 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RHEBL1 pAb (ATL-HPA053111) | |
| Datasheet | Anti RHEBL1 pAb (ATL-HPA053111) Datasheet (External Link) |
| Vendor Page | Anti RHEBL1 pAb (ATL-HPA053111) at Atlas Antibodies |
| Documents & Links for Anti RHEBL1 pAb (ATL-HPA053111) | |
| Datasheet | Anti RHEBL1 pAb (ATL-HPA053111) Datasheet (External Link) |
| Vendor Page | Anti RHEBL1 pAb (ATL-HPA053111) |