Anti RHCE pAb (ATL-HPA077385)

Atlas Antibodies

Catalog No.:
ATL-HPA077385-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Rh blood group CcEe antigens
Gene Name: RHCE
Alternative Gene Name: CD240CE, RH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028825: 70%, ENSRNOG00000017130: 70%
Entrez Gene ID: 6006
Uniprot ID: P18577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
Gene Sequence LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
Gene ID - Mouse ENSMUSG00000028825
Gene ID - Rat ENSRNOG00000017130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHCE pAb (ATL-HPA077385)
Datasheet Anti RHCE pAb (ATL-HPA077385) Datasheet (External Link)
Vendor Page Anti RHCE pAb (ATL-HPA077385) at Atlas Antibodies

Documents & Links for Anti RHCE pAb (ATL-HPA077385)
Datasheet Anti RHCE pAb (ATL-HPA077385) Datasheet (External Link)
Vendor Page Anti RHCE pAb (ATL-HPA077385)