Anti RHCE pAb (ATL-HPA077385)

Atlas Antibodies

Catalog No.: ATL-HPA077385-25

Protein Description: Rh blood group CcEe antigens
Gene Name: RHCE
Alternative Gene Name: CD240CE, RH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028825: 70%, ENSRNOG00000017130: 70%
Entrez Gene ID: 6006
Uniprot ID: P18577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
• Gene Sequence: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
• Gene ID - Mouse: ENSMUSG00000028825
• Gene ID - Rat: ENSRNOG00000017130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.