Anti RHBG pAb (ATL-HPA042726)

Atlas Antibodies

Catalog No.:
ATL-HPA042726-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rh family, B glycoprotein (gene/pseudogene)
Gene Name: RHBG
Alternative Gene Name: SLC42A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103766: 88%, ENSRNOG00000019412: 88%
Entrez Gene ID: 57127
Uniprot ID: Q9H310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATHEAYGDGLESVFPLIAEGQRSATSQAMHQL
Gene Sequence ATHEAYGDGLESVFPLIAEGQRSATSQAMHQL
Gene ID - Mouse ENSMUSG00000103766
Gene ID - Rat ENSRNOG00000019412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RHBG pAb (ATL-HPA042726)
Datasheet Anti RHBG pAb (ATL-HPA042726) Datasheet (External Link)
Vendor Page Anti RHBG pAb (ATL-HPA042726) at Atlas Antibodies

Documents & Links for Anti RHBG pAb (ATL-HPA042726)
Datasheet Anti RHBG pAb (ATL-HPA042726) Datasheet (External Link)
Vendor Page Anti RHBG pAb (ATL-HPA042726)