Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA070193-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: regulator of G-protein signaling 20
Gene Name: RGS20
Alternative Gene Name: RGSZ1, ZGAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002459: 47%, ENSRNOG00000003388: 30%
Entrez Gene ID: 8601
Uniprot ID: O76081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP
Gene Sequence MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP
Gene ID - Mouse ENSMUSG00000002459
Gene ID - Rat ENSRNOG00000003388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation)
Datasheet Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation)
Datasheet Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation)