Anti RGS16 pAb (ATL-HPA053250)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053250-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RGS16
Alternative Gene Name: A28-RGS14, RGS-r
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026475: 81%, ENSRNOG00000027024: 83%
Entrez Gene ID: 6004
Uniprot ID: O15492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED |
Gene Sequence | MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED |
Gene ID - Mouse | ENSMUSG00000026475 |
Gene ID - Rat | ENSRNOG00000027024 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RGS16 pAb (ATL-HPA053250) | |
Datasheet | Anti RGS16 pAb (ATL-HPA053250) Datasheet (External Link) |
Vendor Page | Anti RGS16 pAb (ATL-HPA053250) at Atlas Antibodies |
Documents & Links for Anti RGS16 pAb (ATL-HPA053250) | |
Datasheet | Anti RGS16 pAb (ATL-HPA053250) Datasheet (External Link) |
Vendor Page | Anti RGS16 pAb (ATL-HPA053250) |