Anti RGS16 pAb (ATL-HPA053250)

Atlas Antibodies

Catalog No.:
ATL-HPA053250-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: regulator of G-protein signaling 16
Gene Name: RGS16
Alternative Gene Name: A28-RGS14, RGS-r
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026475: 81%, ENSRNOG00000027024: 83%
Entrez Gene ID: 6004
Uniprot ID: O15492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED
Gene Sequence MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED
Gene ID - Mouse ENSMUSG00000026475
Gene ID - Rat ENSRNOG00000027024
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGS16 pAb (ATL-HPA053250)
Datasheet Anti RGS16 pAb (ATL-HPA053250) Datasheet (External Link)
Vendor Page Anti RGS16 pAb (ATL-HPA053250) at Atlas Antibodies

Documents & Links for Anti RGS16 pAb (ATL-HPA053250)
Datasheet Anti RGS16 pAb (ATL-HPA053250) Datasheet (External Link)
Vendor Page Anti RGS16 pAb (ATL-HPA053250)