Anti RGS16 pAb (ATL-HPA053250)

Atlas Antibodies

Catalog No.: ATL-HPA053250-25

Protein Description: regulator of G-protein signaling 16
Gene Name: RGS16
Alternative Gene Name: A28-RGS14, RGS-r
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026475: 81%, ENSRNOG00000027024: 83%
Entrez Gene ID: 6004
Uniprot ID: O15492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED
• Gene Sequence: MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED
• Gene ID - Mouse: ENSMUSG00000026475
• Gene ID - Rat: ENSRNOG00000027024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.