Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA076656-25

Protein Description: regulator of G protein signaling 13
Gene Name: RGS13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051079: 84%, ENSRNOG00000003888: 83%
Entrez Gene ID: 6003
Uniprot ID: O14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
• Gene Sequence: TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
• Gene ID - Mouse: ENSMUSG00000051079
• Gene ID - Rat: ENSRNOG00000003888
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.