Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA076656-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: regulator of G protein signaling 13
Gene Name: RGS13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051079: 84%, ENSRNOG00000003888: 83%
Entrez Gene ID: 6003
Uniprot ID: O14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
Gene Sequence TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
Gene ID - Mouse ENSMUSG00000051079
Gene ID - Rat ENSRNOG00000003888
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation)
Datasheet Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation)
Datasheet Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation)