Anti RGS12 pAb (ATL-HPA054646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054646-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RGS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029101: 95%, ENSRNOG00000030568: 95%
Entrez Gene ID: 6002
Uniprot ID: O14924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VFMVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQE |
| Gene Sequence | VFMVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQE |
| Gene ID - Mouse | ENSMUSG00000029101 |
| Gene ID - Rat | ENSRNOG00000030568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RGS12 pAb (ATL-HPA054646) | |
| Datasheet | Anti RGS12 pAb (ATL-HPA054646) Datasheet (External Link) |
| Vendor Page | Anti RGS12 pAb (ATL-HPA054646) at Atlas Antibodies |
| Documents & Links for Anti RGS12 pAb (ATL-HPA054646) | |
| Datasheet | Anti RGS12 pAb (ATL-HPA054646) Datasheet (External Link) |
| Vendor Page | Anti RGS12 pAb (ATL-HPA054646) |
| Citations for Anti RGS12 pAb (ATL-HPA054646) – 1 Found |
| Yuan, Gongsheng; Yang, Shuting; Yang, Shuying. RGS12 represses oral squamous cell carcinoma by driving M1 polarization of tumor-associated macrophages via controlling ciliary MYCBP2/KIF2A signaling. International Journal Of Oral Science. 2023;15(1):11. PubMed |