Anti RGS1 pAb (ATL-HPA074572)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074572-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RGS1
Alternative Gene Name: 1R20, BL34, IER1, IR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026358: 92%, ENSRNOG00000003895: 92%
Entrez Gene ID: 5996
Uniprot ID: Q08116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS |
| Gene Sequence | RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS |
| Gene ID - Mouse | ENSMUSG00000026358 |
| Gene ID - Rat | ENSRNOG00000003895 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RGS1 pAb (ATL-HPA074572) | |
| Datasheet | Anti RGS1 pAb (ATL-HPA074572) Datasheet (External Link) |
| Vendor Page | Anti RGS1 pAb (ATL-HPA074572) at Atlas Antibodies |
| Documents & Links for Anti RGS1 pAb (ATL-HPA074572) | |
| Datasheet | Anti RGS1 pAb (ATL-HPA074572) Datasheet (External Link) |
| Vendor Page | Anti RGS1 pAb (ATL-HPA074572) |