Anti RGS1 pAb (ATL-HPA074572)

Atlas Antibodies

Catalog No.: ATL-HPA074572-25

Protein Description: regulator of G protein signaling 1
Gene Name: RGS1
Alternative Gene Name: 1R20, BL34, IER1, IR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026358: 92%, ENSRNOG00000003895: 92%
Entrez Gene ID: 5996
Uniprot ID: Q08116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS
• Gene Sequence: RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS
• Gene ID - Mouse: ENSMUSG00000026358
• Gene ID - Rat: ENSRNOG00000003895
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.