Anti RGS1 pAb (ATL-HPA074572)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074572-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RGS1
Alternative Gene Name: 1R20, BL34, IER1, IR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026358: 92%, ENSRNOG00000003895: 92%
Entrez Gene ID: 5996
Uniprot ID: Q08116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS |
Gene Sequence | RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS |
Gene ID - Mouse | ENSMUSG00000026358 |
Gene ID - Rat | ENSRNOG00000003895 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RGS1 pAb (ATL-HPA074572) | |
Datasheet | Anti RGS1 pAb (ATL-HPA074572) Datasheet (External Link) |
Vendor Page | Anti RGS1 pAb (ATL-HPA074572) at Atlas Antibodies |
Documents & Links for Anti RGS1 pAb (ATL-HPA074572) | |
Datasheet | Anti RGS1 pAb (ATL-HPA074572) Datasheet (External Link) |
Vendor Page | Anti RGS1 pAb (ATL-HPA074572) |