Anti RGPD5 pAb (ATL-HPA045704)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045704-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RGPD5
Alternative Gene Name: BS-63, DKFZp686I1842, RGP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042508: 27%, ENSRNOG00000018144: 27%
Entrez Gene ID: 84220
Uniprot ID: Q99666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS |
| Gene Sequence | APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS |
| Gene ID - Mouse | ENSMUSG00000042508 |
| Gene ID - Rat | ENSRNOG00000018144 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RGPD5 pAb (ATL-HPA045704) | |
| Datasheet | Anti RGPD5 pAb (ATL-HPA045704) Datasheet (External Link) |
| Vendor Page | Anti RGPD5 pAb (ATL-HPA045704) at Atlas Antibodies |
| Documents & Links for Anti RGPD5 pAb (ATL-HPA045704) | |
| Datasheet | Anti RGPD5 pAb (ATL-HPA045704) Datasheet (External Link) |
| Vendor Page | Anti RGPD5 pAb (ATL-HPA045704) |