Anti RGPD1 pAb (ATL-HPA049497)

Atlas Antibodies

SKU: ATL-HPA049497-25

• 

Protein Description: RANBP2-like and GRIP domain containing 1
Gene Name: RGPD1
Alternative Gene Name: RGP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003226: 100%, ENSRNOG00000000796: 100%
Entrez Gene ID: 400966
Uniprot ID: P0DJD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTP
• Gene Sequence: FHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTP
• Gene ID - Mouse: ENSMUSG00000003226
• Gene ID - Rat: ENSRNOG00000000796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.