Anti RGN pAb (ATL-HPA029104)

Atlas Antibodies

Catalog No.:
ATL-HPA029104-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: regucalcin
Gene Name: RGN
Alternative Gene Name: RC, SMP30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023070: 78%, ENSRNOG00000007949: 79%
Entrez Gene ID: 9104
Uniprot ID: Q15493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAV
Gene Sequence CGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAV
Gene ID - Mouse ENSMUSG00000023070
Gene ID - Rat ENSRNOG00000007949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGN pAb (ATL-HPA029104)
Datasheet Anti RGN pAb (ATL-HPA029104) Datasheet (External Link)
Vendor Page Anti RGN pAb (ATL-HPA029104) at Atlas Antibodies

Documents & Links for Anti RGN pAb (ATL-HPA029104)
Datasheet Anti RGN pAb (ATL-HPA029104) Datasheet (External Link)
Vendor Page Anti RGN pAb (ATL-HPA029104)