Anti RGN pAb (ATL-HPA029102 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029102-100

Protein Description: regucalcin
Gene Name: RGN
Alternative Gene Name: RC, SMP30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023070: 92%, ENSRNOG00000007949: 91%
Entrez Gene ID: 9104
Uniprot ID: Q15493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC
• Gene Sequence: ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC
• Gene ID - Mouse: ENSMUSG00000023070
• Gene ID - Rat: ENSRNOG00000007949
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RGN pAb (ATL-HPA029102 w/enhanced validation) – 1 Found

Byström, Sanna; Fredolini, Claudia; Edqvist, Per-Henrik; Nyaiesh, Etienne-Nicholas; Drobin, Kimi; Uhlén, Mathias; Bergqvist, Michael; Pontén, Fredrik; Schwenk, Jochen M. Affinity Proteomics Exploration of Melanoma Identifies Proteins in Serum with Associations to T-Stage and Recurrence. Translational Oncology. 2017;10(3):385-395.