Anti RGL2 pAb (ATL-HPA053444)

Atlas Antibodies

SKU: ATL-HPA053444-25

• 

Protein Description: ral guanine nucleotide dissociation stimulator-like 2
Gene Name: RGL2
Alternative Gene Name: HKE1.5, KE1.5, RAB2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041354: 88%, ENSRNOG00000000474: 88%
Entrez Gene ID: 5863
Uniprot ID: O15211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSR
• Gene Sequence: EALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSR
• Gene ID - Mouse: ENSMUSG00000041354
• Gene ID - Rat: ENSRNOG00000000474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.