Anti RGL2 pAb (ATL-HPA053444)

Atlas Antibodies

Catalog No.:
ATL-HPA053444-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ral guanine nucleotide dissociation stimulator-like 2
Gene Name: RGL2
Alternative Gene Name: HKE1.5, KE1.5, RAB2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041354: 88%, ENSRNOG00000000474: 88%
Entrez Gene ID: 5863
Uniprot ID: O15211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSR
Gene Sequence EALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSR
Gene ID - Mouse ENSMUSG00000041354
Gene ID - Rat ENSRNOG00000000474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RGL2 pAb (ATL-HPA053444)
Datasheet Anti RGL2 pAb (ATL-HPA053444) Datasheet (External Link)
Vendor Page Anti RGL2 pAb (ATL-HPA053444) at Atlas Antibodies

Documents & Links for Anti RGL2 pAb (ATL-HPA053444)
Datasheet Anti RGL2 pAb (ATL-HPA053444) Datasheet (External Link)
Vendor Page Anti RGL2 pAb (ATL-HPA053444)