Anti RFXAP pAb (ATL-HPA032035)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032035-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RFXAP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036615: 96%, ENSRNOG00000056028: 96%
Entrez Gene ID: 5994
Uniprot ID: O00287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT |
| Gene Sequence | NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT |
| Gene ID - Mouse | ENSMUSG00000036615 |
| Gene ID - Rat | ENSRNOG00000056028 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RFXAP pAb (ATL-HPA032035) | |
| Datasheet | Anti RFXAP pAb (ATL-HPA032035) Datasheet (External Link) |
| Vendor Page | Anti RFXAP pAb (ATL-HPA032035) at Atlas Antibodies |
| Documents & Links for Anti RFXAP pAb (ATL-HPA032035) | |
| Datasheet | Anti RFXAP pAb (ATL-HPA032035) Datasheet (External Link) |
| Vendor Page | Anti RFXAP pAb (ATL-HPA032035) |