Anti RFXAP pAb (ATL-HPA032035)

Atlas Antibodies

Catalog No.:
ATL-HPA032035-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: regulatory factor X-associated protein
Gene Name: RFXAP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036615: 96%, ENSRNOG00000056028: 96%
Entrez Gene ID: 5994
Uniprot ID: O00287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT
Gene Sequence NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT
Gene ID - Mouse ENSMUSG00000036615
Gene ID - Rat ENSRNOG00000056028
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RFXAP pAb (ATL-HPA032035)
Datasheet Anti RFXAP pAb (ATL-HPA032035) Datasheet (External Link)
Vendor Page Anti RFXAP pAb (ATL-HPA032035) at Atlas Antibodies

Documents & Links for Anti RFXAP pAb (ATL-HPA032035)
Datasheet Anti RFXAP pAb (ATL-HPA032035) Datasheet (External Link)
Vendor Page Anti RFXAP pAb (ATL-HPA032035)