Anti RFX8 pAb (ATL-HPA059745)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059745-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RFX8
Alternative Gene Name: FLJ42986
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057173: 70%, ENSRNOG00000058243: 71%
Entrez Gene ID: 731220
Uniprot ID: Q6ZV50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLQISKLKEVTLFVKRLRRKTYLSNMAKTMRMVLKSKRRVSVLKSDLQAIINQGTLATSKKALASDRSGADELENNPEMKCL |
Gene Sequence | LLQISKLKEVTLFVKRLRRKTYLSNMAKTMRMVLKSKRRVSVLKSDLQAIINQGTLATSKKALASDRSGADELENNPEMKCL |
Gene ID - Mouse | ENSMUSG00000057173 |
Gene ID - Rat | ENSRNOG00000058243 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RFX8 pAb (ATL-HPA059745) | |
Datasheet | Anti RFX8 pAb (ATL-HPA059745) Datasheet (External Link) |
Vendor Page | Anti RFX8 pAb (ATL-HPA059745) at Atlas Antibodies |
Documents & Links for Anti RFX8 pAb (ATL-HPA059745) | |
Datasheet | Anti RFX8 pAb (ATL-HPA059745) Datasheet (External Link) |
Vendor Page | Anti RFX8 pAb (ATL-HPA059745) |