Anti RFWD3 pAb (ATL-HPA075649)

Atlas Antibodies

Catalog No.:
ATL-HPA075649-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger and WD repeat domain 3
Gene Name: RFWD3
Alternative Gene Name: FLJ10520, RNF201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 60%, ENSRNOG00000024632: 26%
Entrez Gene ID: 55159
Uniprot ID: Q6PCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE
Gene Sequence NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE
Gene ID - Mouse ENSMUSG00000033596
Gene ID - Rat ENSRNOG00000024632
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RFWD3 pAb (ATL-HPA075649)
Datasheet Anti RFWD3 pAb (ATL-HPA075649) Datasheet (External Link)
Vendor Page Anti RFWD3 pAb (ATL-HPA075649) at Atlas Antibodies

Documents & Links for Anti RFWD3 pAb (ATL-HPA075649)
Datasheet Anti RFWD3 pAb (ATL-HPA075649) Datasheet (External Link)
Vendor Page Anti RFWD3 pAb (ATL-HPA075649)