Anti RFPL2 pAb (ATL-HPA048320)

Atlas Antibodies

Catalog No.:
ATL-HPA048320-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ret finger protein-like 2
Gene Name: RFPL2
Alternative Gene Name: RNF79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035191: 50%, ENSRNOG00000015743: 43%
Entrez Gene ID: 10739
Uniprot ID: O75678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQLTTELGFWTVSLRDGGRLSATTVPLTFL
Gene Sequence IQLTTELGFWTVSLRDGGRLSATTVPLTFL
Gene ID - Mouse ENSMUSG00000035191
Gene ID - Rat ENSRNOG00000015743
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RFPL2 pAb (ATL-HPA048320)
Datasheet Anti RFPL2 pAb (ATL-HPA048320) Datasheet (External Link)
Vendor Page Anti RFPL2 pAb (ATL-HPA048320) at Atlas Antibodies

Documents & Links for Anti RFPL2 pAb (ATL-HPA048320)
Datasheet Anti RFPL2 pAb (ATL-HPA048320) Datasheet (External Link)
Vendor Page Anti RFPL2 pAb (ATL-HPA048320)