Anti RFFL pAb (ATL-HPA019492)

Atlas Antibodies

Catalog No.: ATL-HPA019492-100

Protein Description: ring finger and FYVE-like domain containing E3 ubiquitin protein ligase
Gene Name: RFFL
Alternative Gene Name: fring, rififylin, RNF189, RNF34L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020696: 82%, ENSRNOG00000007596: 86%
Entrez Gene ID: 117584
Uniprot ID: Q8WZ73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS
• Gene Sequence: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS
• Gene ID - Mouse: ENSMUSG00000020696
• Gene ID - Rat: ENSRNOG00000007596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.