Anti RFC1 pAb (ATL-HPA069306)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069306-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RFC1
Alternative Gene Name: A1, MHCBFB, PO-GA, RFC140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029191: 98%, ENSRNOG00000002855: 98%
Entrez Gene ID: 5981
Uniprot ID: P35251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII |
| Gene Sequence | LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII |
| Gene ID - Mouse | ENSMUSG00000029191 |
| Gene ID - Rat | ENSRNOG00000002855 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RFC1 pAb (ATL-HPA069306) | |
| Datasheet | Anti RFC1 pAb (ATL-HPA069306) Datasheet (External Link) |
| Vendor Page | Anti RFC1 pAb (ATL-HPA069306) at Atlas Antibodies |
| Documents & Links for Anti RFC1 pAb (ATL-HPA069306) | |
| Datasheet | Anti RFC1 pAb (ATL-HPA069306) Datasheet (External Link) |
| Vendor Page | Anti RFC1 pAb (ATL-HPA069306) |