Anti RFC1 pAb (ATL-HPA069306)

Atlas Antibodies

Catalog No.:
ATL-HPA069306-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: replication factor C (activator 1) 1, 145kDa
Gene Name: RFC1
Alternative Gene Name: A1, MHCBFB, PO-GA, RFC140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029191: 98%, ENSRNOG00000002855: 98%
Entrez Gene ID: 5981
Uniprot ID: P35251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Gene Sequence LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Gene ID - Mouse ENSMUSG00000029191
Gene ID - Rat ENSRNOG00000002855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RFC1 pAb (ATL-HPA069306)
Datasheet Anti RFC1 pAb (ATL-HPA069306) Datasheet (External Link)
Vendor Page Anti RFC1 pAb (ATL-HPA069306) at Atlas Antibodies

Documents & Links for Anti RFC1 pAb (ATL-HPA069306)
Datasheet Anti RFC1 pAb (ATL-HPA069306) Datasheet (External Link)
Vendor Page Anti RFC1 pAb (ATL-HPA069306)