Anti RETNLB pAb (ATL-HPA049152)

Atlas Antibodies

Catalog No.:
ATL-HPA049152-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: resistin like beta
Gene Name: RETNLB
Alternative Gene Name: FIZZ2, HXCP2, RELMb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022651: 56%, ENSRNOG00000001943: 60%
Entrez Gene ID: 84666
Uniprot ID: Q9BQ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Gene Sequence LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Gene ID - Mouse ENSMUSG00000022651
Gene ID - Rat ENSRNOG00000001943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RETNLB pAb (ATL-HPA049152)
Datasheet Anti RETNLB pAb (ATL-HPA049152) Datasheet (External Link)
Vendor Page Anti RETNLB pAb (ATL-HPA049152) at Atlas Antibodies

Documents & Links for Anti RETNLB pAb (ATL-HPA049152)
Datasheet Anti RETNLB pAb (ATL-HPA049152) Datasheet (External Link)
Vendor Page Anti RETNLB pAb (ATL-HPA049152)