Anti REPS2 pAb (ATL-HPA026073)

Atlas Antibodies

Catalog No.:
ATL-HPA026073-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RALBP1 associated Eps domain containing 2
Gene Name: REPS2
Alternative Gene Name: POB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040855: 88%, ENSRNOG00000061508: 83%
Entrez Gene ID: 9185
Uniprot ID: Q8NFH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDVTSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSRASSLDLN
Gene Sequence YPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDVTSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSRASSLDLN
Gene ID - Mouse ENSMUSG00000040855
Gene ID - Rat ENSRNOG00000061508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REPS2 pAb (ATL-HPA026073)
Datasheet Anti REPS2 pAb (ATL-HPA026073) Datasheet (External Link)
Vendor Page Anti REPS2 pAb (ATL-HPA026073) at Atlas Antibodies

Documents & Links for Anti REPS2 pAb (ATL-HPA026073)
Datasheet Anti REPS2 pAb (ATL-HPA026073) Datasheet (External Link)
Vendor Page Anti REPS2 pAb (ATL-HPA026073)