Anti REPIN1 pAb (ATL-HPA036022)

Atlas Antibodies

Catalog No.:
ATL-HPA036022-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: replication initiator 1
Gene Name: REPIN1
Alternative Gene Name: AP4, H_DJ0584D14.12, RIP60, Zfp464, ZNF464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052751: 72%, ENSRNOG00000008239: 74%
Entrez Gene ID: 29803
Uniprot ID: Q9BWE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE
Gene Sequence MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE
Gene ID - Mouse ENSMUSG00000052751
Gene ID - Rat ENSRNOG00000008239
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REPIN1 pAb (ATL-HPA036022)
Datasheet Anti REPIN1 pAb (ATL-HPA036022) Datasheet (External Link)
Vendor Page Anti REPIN1 pAb (ATL-HPA036022) at Atlas Antibodies

Documents & Links for Anti REPIN1 pAb (ATL-HPA036022)
Datasheet Anti REPIN1 pAb (ATL-HPA036022) Datasheet (External Link)
Vendor Page Anti REPIN1 pAb (ATL-HPA036022)