Anti REP15 pAb (ATL-HPA059868)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059868-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: REP15
Alternative Gene Name: RAB15EP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040121: 68%, ENSRNOG00000001840: 67%
Entrez Gene ID: 387849
Uniprot ID: Q6BDI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FEYPPSKLCPAANTLNEIFLIHFITFCQEKGVDEWLTTTKMTKHQAFLFGADWIWTFWGSDKQIKLQLAVQTLQMSSPPPVESKPCDLSNPESRV |
| Gene Sequence | FEYPPSKLCPAANTLNEIFLIHFITFCQEKGVDEWLTTTKMTKHQAFLFGADWIWTFWGSDKQIKLQLAVQTLQMSSPPPVESKPCDLSNPESRV |
| Gene ID - Mouse | ENSMUSG00000040121 |
| Gene ID - Rat | ENSRNOG00000001840 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti REP15 pAb (ATL-HPA059868) | |
| Datasheet | Anti REP15 pAb (ATL-HPA059868) Datasheet (External Link) |
| Vendor Page | Anti REP15 pAb (ATL-HPA059868) at Atlas Antibodies |
| Documents & Links for Anti REP15 pAb (ATL-HPA059868) | |
| Datasheet | Anti REP15 pAb (ATL-HPA059868) Datasheet (External Link) |
| Vendor Page | Anti REP15 pAb (ATL-HPA059868) |