Anti REM1 pAb (ATL-HPA049821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049821-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: REM1
Alternative Gene Name: GES, REM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000359: 85%, ENSRNOG00000007567: 87%
Entrez Gene ID: 28954
Uniprot ID: O75628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD |
Gene Sequence | QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD |
Gene ID - Mouse | ENSMUSG00000000359 |
Gene ID - Rat | ENSRNOG00000007567 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti REM1 pAb (ATL-HPA049821) | |
Datasheet | Anti REM1 pAb (ATL-HPA049821) Datasheet (External Link) |
Vendor Page | Anti REM1 pAb (ATL-HPA049821) at Atlas Antibodies |
Documents & Links for Anti REM1 pAb (ATL-HPA049821) | |
Datasheet | Anti REM1 pAb (ATL-HPA049821) Datasheet (External Link) |
Vendor Page | Anti REM1 pAb (ATL-HPA049821) |