Anti REM1 pAb (ATL-HPA049821)

Atlas Antibodies

Catalog No.:
ATL-HPA049821-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAS (RAD and GEM)-like GTP-binding 1
Gene Name: REM1
Alternative Gene Name: GES, REM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000359: 85%, ENSRNOG00000007567: 87%
Entrez Gene ID: 28954
Uniprot ID: O75628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD
Gene Sequence QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD
Gene ID - Mouse ENSMUSG00000000359
Gene ID - Rat ENSRNOG00000007567
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REM1 pAb (ATL-HPA049821)
Datasheet Anti REM1 pAb (ATL-HPA049821) Datasheet (External Link)
Vendor Page Anti REM1 pAb (ATL-HPA049821) at Atlas Antibodies

Documents & Links for Anti REM1 pAb (ATL-HPA049821)
Datasheet Anti REM1 pAb (ATL-HPA049821) Datasheet (External Link)
Vendor Page Anti REM1 pAb (ATL-HPA049821)