Anti REM1 pAb (ATL-HPA049821)

Atlas Antibodies

Catalog No.: ATL-HPA049821-25

Protein Description: RAS (RAD and GEM)-like GTP-binding 1
Gene Name: REM1
Alternative Gene Name: GES, REM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000359: 85%, ENSRNOG00000007567: 87%
Entrez Gene ID: 28954
Uniprot ID: O75628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD
• Gene Sequence: QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD
• Gene ID - Mouse: ENSMUSG00000000359
• Gene ID - Rat: ENSRNOG00000007567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.