Anti RELT pAb (ATL-HPA062824)

Atlas Antibodies

Catalog No.:
ATL-HPA062824-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RELT tumor necrosis factor receptor
Gene Name: RELT
Alternative Gene Name: FLJ14993, TNFRSF19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008318: 92%, ENSRNOG00000025075: 90%
Entrez Gene ID: 84957
Uniprot ID: Q969Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHIC
Gene Sequence GGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHIC
Gene ID - Mouse ENSMUSG00000008318
Gene ID - Rat ENSRNOG00000025075
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RELT pAb (ATL-HPA062824)
Datasheet Anti RELT pAb (ATL-HPA062824) Datasheet (External Link)
Vendor Page Anti RELT pAb (ATL-HPA062824) at Atlas Antibodies

Documents & Links for Anti RELT pAb (ATL-HPA062824)
Datasheet Anti RELT pAb (ATL-HPA062824) Datasheet (External Link)
Vendor Page Anti RELT pAb (ATL-HPA062824)