Anti RELA pAb (ATL-HPA063461)

Atlas Antibodies

SKU: ATL-HPA063461-25

• 

Protein Description: v-rel avian reticuloendotheliosis viral oncogene homolog A
Gene Name: RELA
Alternative Gene Name: NFKB3, p65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024927: 98%, ENSRNOG00000030888: 100%
Entrez Gene ID: 5970
Uniprot ID: Q04206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
• Gene Sequence: GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
• Gene ID - Mouse: ENSMUSG00000024927
• Gene ID - Rat: ENSRNOG00000030888
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.