Anti RELA pAb (ATL-HPA063461)

Atlas Antibodies

Catalog No.:
ATL-HPA063461-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: v-rel avian reticuloendotheliosis viral oncogene homolog A
Gene Name: RELA
Alternative Gene Name: NFKB3, p65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024927: 98%, ENSRNOG00000030888: 100%
Entrez Gene ID: 5970
Uniprot ID: Q04206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
Gene Sequence GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
Gene ID - Mouse ENSMUSG00000024927
Gene ID - Rat ENSRNOG00000030888
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RELA pAb (ATL-HPA063461)
Datasheet Anti RELA pAb (ATL-HPA063461) Datasheet (External Link)
Vendor Page Anti RELA pAb (ATL-HPA063461) at Atlas Antibodies

Documents & Links for Anti RELA pAb (ATL-HPA063461)
Datasheet Anti RELA pAb (ATL-HPA063461) Datasheet (External Link)
Vendor Page Anti RELA pAb (ATL-HPA063461)