Anti REG3A pAb (ATL-HPA060705)

Atlas Antibodies

Catalog No.:
ATL-HPA060705-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: regenerating islet-derived 3 alpha
Gene Name: REG3A
Alternative Gene Name: HIP, PAP, PAP1, PBCGF, REG-III, REG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071356: 70%, ENSRNOG00000006151: 70%
Entrez Gene ID: 5068
Uniprot ID: Q06141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL
Gene Sequence YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL
Gene ID - Mouse ENSMUSG00000071356
Gene ID - Rat ENSRNOG00000006151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REG3A pAb (ATL-HPA060705)
Datasheet Anti REG3A pAb (ATL-HPA060705) Datasheet (External Link)
Vendor Page Anti REG3A pAb (ATL-HPA060705) at Atlas Antibodies

Documents & Links for Anti REG3A pAb (ATL-HPA060705)
Datasheet Anti REG3A pAb (ATL-HPA060705) Datasheet (External Link)
Vendor Page Anti REG3A pAb (ATL-HPA060705)