Anti REG3A pAb (ATL-HPA048334)

Atlas Antibodies

Catalog No.: ATL-HPA048334-25

Protein Description: regenerating islet-derived 3 alpha
Gene Name: REG3A
Alternative Gene Name: HIP, PAP, PAP1, PBCGF, REG-III, REG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079516: 75%, ENSRNOG00000006579: 78%
Entrez Gene ID: 5068
Uniprot ID: Q06141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAYGSHCYALFLSPKSWTDADLACQKRPSGNL
• Gene Sequence: KAYGSHCYALFLSPKSWTDADLACQKRPSGNL
• Gene ID - Mouse: ENSMUSG00000079516
• Gene ID - Rat: ENSRNOG00000006579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.