Anti REEP5 pAb (ATL-HPA069960)

Atlas Antibodies

Catalog No.:
ATL-HPA069960-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: receptor accessory protein 5
Gene Name: REEP5
Alternative Gene Name: C5orf18, D5S346, DP1, TB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005873: 84%, ENSRNOG00000020167: 86%
Entrez Gene ID: 7905
Uniprot ID: Q00765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE
Gene Sequence PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE
Gene ID - Mouse ENSMUSG00000005873
Gene ID - Rat ENSRNOG00000020167
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti REEP5 pAb (ATL-HPA069960)
Datasheet Anti REEP5 pAb (ATL-HPA069960) Datasheet (External Link)
Vendor Page Anti REEP5 pAb (ATL-HPA069960) at Atlas Antibodies

Documents & Links for Anti REEP5 pAb (ATL-HPA069960)
Datasheet Anti REEP5 pAb (ATL-HPA069960) Datasheet (External Link)
Vendor Page Anti REEP5 pAb (ATL-HPA069960)