Anti REEP5 pAb (ATL-HPA069960)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069960-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: REEP5
Alternative Gene Name: C5orf18, D5S346, DP1, TB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005873: 84%, ENSRNOG00000020167: 86%
Entrez Gene ID: 7905
Uniprot ID: Q00765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE |
Gene Sequence | PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE |
Gene ID - Mouse | ENSMUSG00000005873 |
Gene ID - Rat | ENSRNOG00000020167 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti REEP5 pAb (ATL-HPA069960) | |
Datasheet | Anti REEP5 pAb (ATL-HPA069960) Datasheet (External Link) |
Vendor Page | Anti REEP5 pAb (ATL-HPA069960) at Atlas Antibodies |
Documents & Links for Anti REEP5 pAb (ATL-HPA069960) | |
Datasheet | Anti REEP5 pAb (ATL-HPA069960) Datasheet (External Link) |
Vendor Page | Anti REEP5 pAb (ATL-HPA069960) |