Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067546-25

• 

Protein Description: RAD52 motif containing 1
Gene Name: RDM1
Alternative Gene Name: MGC33977, RAD52B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010362: 78%, ENSRNOG00000020751: 78%
Entrez Gene ID: 201299
Uniprot ID: Q8NG50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHR
• Gene Sequence: AELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHR
• Gene ID - Mouse: ENSMUSG00000010362
• Gene ID - Rat: ENSRNOG00000020751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.