Anti RDH8 pAb (ATL-HPA064473)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064473-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RDH8
Alternative Gene Name: PRRDH, SDR28C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053773: 72%, ENSRNOG00000025767: 75%
Entrez Gene ID: 50700
Uniprot ID: Q9NYR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL |
Gene Sequence | VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL |
Gene ID - Mouse | ENSMUSG00000053773 |
Gene ID - Rat | ENSRNOG00000025767 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RDH8 pAb (ATL-HPA064473) | |
Datasheet | Anti RDH8 pAb (ATL-HPA064473) Datasheet (External Link) |
Vendor Page | Anti RDH8 pAb (ATL-HPA064473) at Atlas Antibodies |
Documents & Links for Anti RDH8 pAb (ATL-HPA064473) | |
Datasheet | Anti RDH8 pAb (ATL-HPA064473) Datasheet (External Link) |
Vendor Page | Anti RDH8 pAb (ATL-HPA064473) |