Anti RDH8 pAb (ATL-HPA064473)

Atlas Antibodies

Catalog No.:
ATL-HPA064473-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: retinol dehydrogenase 8 (all-trans)
Gene Name: RDH8
Alternative Gene Name: PRRDH, SDR28C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053773: 72%, ENSRNOG00000025767: 75%
Entrez Gene ID: 50700
Uniprot ID: Q9NYR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL
Gene Sequence VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL
Gene ID - Mouse ENSMUSG00000053773
Gene ID - Rat ENSRNOG00000025767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RDH8 pAb (ATL-HPA064473)
Datasheet Anti RDH8 pAb (ATL-HPA064473) Datasheet (External Link)
Vendor Page Anti RDH8 pAb (ATL-HPA064473) at Atlas Antibodies

Documents & Links for Anti RDH8 pAb (ATL-HPA064473)
Datasheet Anti RDH8 pAb (ATL-HPA064473) Datasheet (External Link)
Vendor Page Anti RDH8 pAb (ATL-HPA064473)