Anti RDH5 pAb (ATL-HPA063345)

Atlas Antibodies

Catalog No.: ATL-HPA063345-25

Protein Description: retinol dehydrogenase 5 (11-cis/9-cis)
Gene Name: RDH5
Alternative Gene Name: HSD17B9, RDH1, SDR9C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025350: 92%, ENSRNOG00000053850: 95%
Entrez Gene ID: 5959
Uniprot ID: Q92781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
• Gene Sequence: NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
• Gene ID - Mouse: ENSMUSG00000025350
• Gene ID - Rat: ENSRNOG00000053850
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.