Anti RDH5 pAb (ATL-HPA063345)

Atlas Antibodies

SKU:
ATL-HPA063345-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: retinol dehydrogenase 5 (11-cis/9-cis)
Gene Name: RDH5
Alternative Gene Name: HSD17B9, RDH1, SDR9C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025350: 92%, ENSRNOG00000053850: 95%
Entrez Gene ID: 5959
Uniprot ID: Q92781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Gene Sequence NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Gene ID - Mouse ENSMUSG00000025350
Gene ID - Rat ENSRNOG00000053850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RDH5 pAb (ATL-HPA063345)
Datasheet Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link)
Vendor Page Anti RDH5 pAb (ATL-HPA063345) at Atlas Antibodies

Documents & Links for Anti RDH5 pAb (ATL-HPA063345)
Datasheet Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link)
Vendor Page Anti RDH5 pAb (ATL-HPA063345)