Anti RDH14 pAb (ATL-HPA056686)

Atlas Antibodies

Catalog No.:
ATL-HPA056686-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: retinol dehydrogenase 14 (all-trans/9-cis/11-cis)
Gene Name: RDH14
Alternative Gene Name: PAN2, SDR7C4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020621: 94%, ENSRNOG00000039551: 96%
Entrez Gene ID: 57665
Uniprot ID: Q9HBH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL
Gene Sequence QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL
Gene ID - Mouse ENSMUSG00000020621
Gene ID - Rat ENSRNOG00000039551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RDH14 pAb (ATL-HPA056686)
Datasheet Anti RDH14 pAb (ATL-HPA056686) Datasheet (External Link)
Vendor Page Anti RDH14 pAb (ATL-HPA056686) at Atlas Antibodies

Documents & Links for Anti RDH14 pAb (ATL-HPA056686)
Datasheet Anti RDH14 pAb (ATL-HPA056686) Datasheet (External Link)
Vendor Page Anti RDH14 pAb (ATL-HPA056686)
Citations for Anti RDH14 pAb (ATL-HPA056686) – 1 Found
Pastore, Stephen F; Muhammad, Tahir; Harripaul, Ricardo; Lau, Rebecca; Khan, Muhammad Tariq Masood; Khan, Muhammad Ismail; Islam, Omar; Kang, Changsoo; Ayub, Muhammad; Jelani, Musharraf; Vincent, John B. Biallelic inheritance in a single Pakistani family with intellectual disability implicates new candidate gene RDH14. Scientific Reports. 2021;11(1):23113.  PubMed