Anti RDH14 pAb (ATL-HPA056686)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056686-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RDH14
Alternative Gene Name: PAN2, SDR7C4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020621: 94%, ENSRNOG00000039551: 96%
Entrez Gene ID: 57665
Uniprot ID: Q9HBH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL |
Gene Sequence | QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL |
Gene ID - Mouse | ENSMUSG00000020621 |
Gene ID - Rat | ENSRNOG00000039551 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RDH14 pAb (ATL-HPA056686) | |
Datasheet | Anti RDH14 pAb (ATL-HPA056686) Datasheet (External Link) |
Vendor Page | Anti RDH14 pAb (ATL-HPA056686) at Atlas Antibodies |
Documents & Links for Anti RDH14 pAb (ATL-HPA056686) | |
Datasheet | Anti RDH14 pAb (ATL-HPA056686) Datasheet (External Link) |
Vendor Page | Anti RDH14 pAb (ATL-HPA056686) |
Citations for Anti RDH14 pAb (ATL-HPA056686) – 1 Found |
Pastore, Stephen F; Muhammad, Tahir; Harripaul, Ricardo; Lau, Rebecca; Khan, Muhammad Tariq Masood; Khan, Muhammad Ismail; Islam, Omar; Kang, Changsoo; Ayub, Muhammad; Jelani, Musharraf; Vincent, John B. Biallelic inheritance in a single Pakistani family with intellectual disability implicates new candidate gene RDH14. Scientific Reports. 2021;11(1):23113. PubMed |