Anti RD3L pAb (ATL-HPA067971)

Atlas Antibodies

Catalog No.:
ATL-HPA067971-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: retinal degeneration 3-like
Gene Name: RD3L
Alternative Gene Name: TDRD9-AS1, TDRD9AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091402: 59%, ENSRNOG00000043031: 60%
Entrez Gene ID: 647286
Uniprot ID: P0DJH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL
Gene Sequence VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL
Gene ID - Mouse ENSMUSG00000091402
Gene ID - Rat ENSRNOG00000043031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RD3L pAb (ATL-HPA067971)
Datasheet Anti RD3L pAb (ATL-HPA067971) Datasheet (External Link)
Vendor Page Anti RD3L pAb (ATL-HPA067971) at Atlas Antibodies

Documents & Links for Anti RD3L pAb (ATL-HPA067971)
Datasheet Anti RD3L pAb (ATL-HPA067971) Datasheet (External Link)
Vendor Page Anti RD3L pAb (ATL-HPA067971)