Anti RCSD1 pAb (ATL-HPA073490)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073490-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RCSD1
Alternative Gene Name: CapZIP, MGC21854, MK2S4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040723: 86%, ENSRNOG00000003283: 88%
Entrez Gene ID: 92241
Uniprot ID: Q6JBY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSL |
| Gene Sequence | MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSL |
| Gene ID - Mouse | ENSMUSG00000040723 |
| Gene ID - Rat | ENSRNOG00000003283 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCSD1 pAb (ATL-HPA073490) | |
| Datasheet | Anti RCSD1 pAb (ATL-HPA073490) Datasheet (External Link) |
| Vendor Page | Anti RCSD1 pAb (ATL-HPA073490) at Atlas Antibodies |
| Documents & Links for Anti RCSD1 pAb (ATL-HPA073490) | |
| Datasheet | Anti RCSD1 pAb (ATL-HPA073490) Datasheet (External Link) |
| Vendor Page | Anti RCSD1 pAb (ATL-HPA073490) |