Anti RCOR2 pAb (ATL-HPA021638)

Atlas Antibodies

Catalog No.: ATL-HPA021638-25

Protein Description: REST corepressor 2
Gene Name: RCOR2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024968: 99%, ENSRNOG00000060849: 99%
Entrez Gene ID: 283248
Uniprot ID: Q8IZ40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK
• Gene Sequence: PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK
• Gene ID - Mouse: ENSMUSG00000024968
• Gene ID - Rat: ENSRNOG00000060849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RCOR2 pAb (ATL-HPA021638) – 4 Found

Barrios, Álvaro P; Gómez, Andrea V; Sáez, Julián E; Ciossani, Giuseppe; Toffolo, Emanuela; Battaglioli, Elena; Mattevi, Andrea; Andrés, María E. Differential properties of transcriptional complexes formed by the CoREST family. Molecular And Cellular Biology. 2014;34(14):2760-70. 

Sáez, Julián Esteban; Gómez, Andrea Verónica; Barrios, Álvaro Patricio; Parada, Guillermo Eduardo; Galdames, Leopoldo; González, Marcela; Andrés, María Estela. Decreased Expression of CoREST1 and CoREST2 Together with LSD1 and HDAC1/2 during Neuronal Differentiation. Plos One. 10(6):e0131760. 

Noches, Verónica; Rivera, Carlos; González, Marcela P; Merello, Gianluca; Olivares-Costa, Montserrat; Andrés, María Estela. Pilocarpine-induced seizures associate with modifications of LSD1/CoREST/HDAC1/2 epigenetic complex and repressive chromatin in mice hippocampus. Biochemistry And Biophysics Reports. 2021;25( 33426312):100889. 

Rivera, Carlos; Verbel-Vergara, Daniel; Arancibia, Duxan; Lappala, Anna; González, Marcela; Guzmán, Fabián; Merello, Gianluca; Lee, Jeannie T; Andrés, María Estela. Revealing RCOR2 as a regulatory component of nuclear speckles. Epigenetics & Chromatin. 2021;14(1):51.