Anti RCOR1 pAb (ATL-HPA054241)

Atlas Antibodies

Catalog No.:
ATL-HPA054241-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: REST corepressor 1
Gene Name: RCOR1
Alternative Gene Name: COREST, KIAA0071, RCOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037896: 98%, ENSRNOG00000046445: 58%
Entrez Gene ID: 23186
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLV
Gene Sequence SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLV
Gene ID - Mouse ENSMUSG00000037896
Gene ID - Rat ENSRNOG00000046445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RCOR1 pAb (ATL-HPA054241)
Datasheet Anti RCOR1 pAb (ATL-HPA054241) Datasheet (External Link)
Vendor Page Anti RCOR1 pAb (ATL-HPA054241) at Atlas Antibodies

Documents & Links for Anti RCOR1 pAb (ATL-HPA054241)
Datasheet Anti RCOR1 pAb (ATL-HPA054241) Datasheet (External Link)
Vendor Page Anti RCOR1 pAb (ATL-HPA054241)