Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030694-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RCN2
Alternative Gene Name: E6BP, ERC-55, ERC55, TCBP49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032320: 91%, ENSRNOG00000015780: 90%
Entrez Gene ID: 5955
Uniprot ID: Q14257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK |
| Gene Sequence | AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK |
| Gene ID - Mouse | ENSMUSG00000032320 |
| Gene ID - Rat | ENSRNOG00000015780 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation) | |
| Datasheet | Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation) | |
| Datasheet | Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RCN2 pAb (ATL-HPA030694 w/enhanced validation) |