Anti RCN1 pAb (ATL-HPA062104 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA062104-25

Protein Description: reticulocalbin 1, EF-hand calcium binding domain
Gene Name: RCN1
Alternative Gene Name: FLJ37041, PIG20, Rcal, RCN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005973: 100%, ENSRNOG00000013452: 100%
Entrez Gene ID: 5954
Uniprot ID: Q15293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPTVRKERVVRPDSELGERPPEDNQSFQYDHEA
• Gene Sequence: KPTVRKERVVRPDSELGERPPEDNQSFQYDHEA
• Gene ID - Mouse: ENSMUSG00000005973
• Gene ID - Rat: ENSRNOG00000013452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.